Reference · Growth factor
Sermorelin
Sermorelin is a synthetic 29-amino-acid peptide, GRF(1-29) amide, corresponding to the N-terminal fragment of human growth hormone-releasing hormone (GHRH) and reported to retain the activity of the full-length peptide. It was formerly approved in the United States as Geref for diagnostic evaluation of pituitary growth hormone secretion and for paediatric idiopathic growth hormone deficiency; the approvals were withdrawn in 2009 following commercial discontinuation, which the FDA determined was unrelated to safety or effectiveness. Published paediatric endocrinology literature includes comparative clinical studies in children with growth hormone deficiency (Chen et al., Acta Paediatrica Suppl 1993) and reviews of its diagnostic and clinical development history (Prakash and Goa, BioDrugs 1999).
Research use only. Not for human or veterinary use. This page describes what the compound is and what published literature has examined; it is not guidance on use.
Chemistry
- Class
- Growth factor
- CAS number
- 86168-78-7
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.9 g/mol (free base)
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 amino acids, GRF 1–29)
- Physical form
- Sterile freeze-dried powder
Available as
| Material | Vial | Price | Per mg | Purity | |
|---|---|---|---|---|---|
| Sermorelin 10mgSERM-10 | 10 mg | $110 | $11.00/mg | ✓ 99.51% | Details → |
Flat $20 US shipping, or free local pickup across Southwest Florida and Greater Philadelphia. Request a quote →
Common questions
What is the CAS number for Sermorelin?
86168-78-7.
What is the molecular formula and weight of Sermorelin?
Sermorelin has molecular formula C149H246N44O42S and a molecular weight 3357.9 g/mol (free base).
What is the sequence of Sermorelin?
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 amino acids, GRF 1–29).
What strengths of Sermorelin are available?
10 mg, supplied as lyophilised powder. Each carries a measured purity result for the lot in stock.
Is Sermorelin approved for human use?
No. Sermorelin supplied here is a research material for laboratory use only. It is not approved by the FDA or any other regulator for human or veterinary use, and nothing on this page is guidance on use.