Held and shipped from a United States warehouse. How testing works

CAUSALABS
Account Cart Contact
Sermorelin 10mg vial

Photographed vial, representative of this material at this strength. Vials ship dry; no diluent is included.

Growth factor

Sermorelin 10mg

99.51% purity

Independently measured

Lot CL-2608-SERM10-A

View certificate
$110 $11.00 / mg · single 10 mg vial

Bundle & save

Pick how many, then add to cart. Same product, same order. Mix-and-match bundles are here.

Sourced to order · in hand within 2 days 40 available

US shipping $20 flat, or free local pickup. Same-week local pickup across Southwest Florida and Greater Philadelphia.

View cart → How testing works →

Part of the Summer 2026 Drop. Not restocked mid-drop — the next batch is a different lot with its own certificate.

For research use only. Not for human consumption. Not approved for medical use, treatment, or diagnosis.

Specification

Compound
Sermorelin
Strength per vial
10 mg
Format
Single 10 mg vial - 2 or more for 15% off
Mass per vial
10 mg
Form
Sterile freeze-dried powder
Category
Growth factor
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 amino acids, GRF 1–29)
CAS number
86168-78-7
Molecular weight
3357.9 g/mol (free base)
Molecular formula
C149H246N44O42S
Testing laboratory
Not published

Research context

Sermorelin is a synthetic 29-amino-acid peptide, GRF(1-29) amide, corresponding to the N-terminal fragment of human growth hormone-releasing hormone (GHRH) and reported to retain the activity of the full-length peptide.

Full Sermorelin reference — chemistry, sequence and published context →

Storage & laboratory handling

  • Supplied as a sterile freeze-dried (lyophilised) powder, sealed under vacuum.
  • Ships dry. The vial is not reconstituted, and no diluent or solvent is included or sold with it.
  • Store the unopened vial refrigerated and protected from light.
  • Allow the vial to reach room temperature before breaking the seal, to limit condensation.
  • Handle under conditions appropriate to your laboratory's protocols.

Handling guidance covers storage of the material as supplied. It is not preparation or administration guidance, and none is provided.

Verification

Sermorelin is HPLC-MS tested for identity, purity and mass by an independent laboratory before it is listed. A certificate names the lot number printed on the box, so the document and the vial in front of you refer to the same batch, and is available on request.

Certificate for lot CL-2608-SERM10-A →

Related materials

Common questions

What exactly is in a vial of Sermorelin 10mg?

10 mg of Sermorelin as Sterile freeze-dried powder, in a 3 mL vial, sealed and shipped dry. No diluent is included. The lot number is printed on the box.

What is the measured purity of Sermorelin 10mg?

The current lot, CL-2608-SERM10-A, measured 99.51% by HPLC-MS at an independent third-party laboratory. Purity is the proportion of the sample that is this compound; it is not the same as how much peptide is in the vial. How to read a COA.

Does Sermorelin 10mg come with a Certificate of Analysis?

Yes - a certificate for the lot you receive is available on request. Quote the lot number printed on the box. The certificate names that lot specifically; it is never averaged across batches or reused from an earlier one.

How is Sermorelin 10mg shipped and stored?

It travels as a freeze-dried powder, which is stable in transit without a cold chain. Shipping is $20 flat anywhere in the United States, or free local pickup and delivery across Southwest Florida and Greater Philadelphia. Store the sealed vial as described on the label.

Is Sermorelin 10mg approved for human use?

No. This material is supplied to qualified researchers for laboratory use only. It is not approved by the FDA or any other regulator for human or veterinary use, and nothing on this site is guidance on use.