Reference comparison
Tesamorelin vs Sermorelin
Two GHRH analogues that differ in modification and in how far each has been characterised clinically.
Research use only. Not for human or veterinary use. This page compares what each compound is and what published literature has examined. It does not describe outcomes, does not recommend either material, and is not guidance on use.
Side by side
| Tesamorelin | Sermorelin | |
|---|---|---|
| Class | Growth factor | Growth factor |
| CAS number | 218949-48-5 | 86168-78-7 |
| Molecular formula | C221H366N72O67S | C149H246N44O42S |
| Molecular weight | 5135.9 g/mol (free base) | 3357.9 g/mol (free base) |
| Sequence | 44 amino acids — trans-3-hexenoyl hGHRH(1–44) amide | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 amino acids, GRF 1–29) |
| Vial strengths | 10 mg, 20 mg | 10 mg |
| From | $125 | $110 |
| Purity (current lot) | 99.64% | 99.51% |
| Physical form | Sterile freeze-dried powder | Sterile freeze-dried powder |
Every figure above is the published value for the lot currently in stock. How our testing works →
How they differ
Structure
Both are based on growth-hormone-releasing hormone. Sermorelin is the unmodified 1-29 fragment. Tesamorelin is a longer analogue carrying a trans-3-hexenoyl group at the N-terminus, a modification that confers resistance to degradation by dipeptidyl peptidase-4.
Stability
The N-terminal modification is the point of tesamorelin: unmodified GHRH analogues are cleaved rapidly, and the added group slows that. This is a chemistry difference with direct consequences for handling and for pharmacokinetics in published work.
Regulatory status
Tesamorelin has been the subject of registrational clinical programmes, and a pharmaceutical product containing it holds a United States approval for a specific indication. Sermorelin has a longer history of use as a diagnostic agent. Neither of those approved products is what is supplied here: this material is for laboratory research only, is not a medicine, and is not approved for any use.
Scale
Both are supplied at 10 mg per vial as sterile lyophilised powder, with a certificate published against the lot.
Both, as supplied
Flat $20 US shipping, or free local pickup across Southwest Florida and Greater Philadelphia. Request a quote → · Other comparisons →