Held and shipped from a United States warehouse. How testing works

CAUSALABS
Account Cart Contact
IGF-1 LR3 1mg vial

Product render, not a photograph — the vial and label are shown as supplied. Vials ship dry; no diluent is included.

Growth factor

IGF-1 LR3 1mg

—assay pending

No certificate is published for this lot yet. Ask before ordering and we will tell you exactly where its testing stands.

Lot number assigned when the batch arrives

$92 $92.00 / mg · single 1 mg vial

Bundle & save

Pick how many, then add to cart. Same product, same order. Mix-and-match bundles are here.

Sourced to order · in hand within 2 days

US shipping $20 flat, or free local pickup. Same-week local pickup across Southwest Florida and Greater Philadelphia.

View cart → How testing works →

Part of the Summer 2026 Drop. Not restocked mid-drop — the next batch is a different lot with its own certificate.

For research use only. Not for human consumption. Not approved for medical use, treatment, or diagnosis.

Specification

Compound
IGF-1 LR3
Strength per vial
1 mg
Format
Single 1 mg vial - 2 or more for 15% off
Mass per vial
1 mg
Form
Sterile freeze-dried powder
Category
Growth factor
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids; human IGF-I with Arg3 substitution and 13-residue N-terminal extension MFPAMPLSSLFVN; three disulfide bonds Cys19-Cys61, Cys31-Cys74, Cys60-Cys65)
CAS number
143045-27-6 (also cited 946870-92-4)
Molecular weight
9111.5 g/mol (recombinant free protein, three disulfide bonds)
Molecular formula
C400H619N111O115S9
Testing laboratory
Not published

Research context

IGF-1 LR3 (Long R3 IGF-I) is an 83-residue recombinant analogue of human insulin-like growth factor-I with arginine replacing glutamate 3 and a 13-residue N-terminal extension from methionyl porcine growth hormone.

Full IGF-1 LR3 reference — chemistry, sequence and published context →

Storage & laboratory handling

  • Supplied as a sterile freeze-dried (lyophilised) powder, sealed under vacuum.
  • Ships dry. The vial is not reconstituted, and no diluent or solvent is included or sold with it.
  • Store the unopened vial refrigerated and protected from light.
  • Allow the vial to reach room temperature before breaking the seal, to limit condensation.
  • Handle under conditions appropriate to your laboratory's protocols.

Handling guidance covers storage of the material as supplied. It is not preparation or administration guidance, and none is provided.

Verification

IGF-1 LR3 is HPLC-MS tested for identity, purity and mass by an independent laboratory before it is listed. A certificate names the lot number printed on the box, so the document and the vial in front of you refer to the same batch, and is available on request.

No certificate is published for this material yet. It is sourced to order; the lot number and its certificate follow the batch that arrives, and nothing above should be read as a result for that batch.

Sourced to order. The lot number and its certificate follow the batch that arrives.

Related materials

Common questions

What exactly is in a vial of IGF-1 LR3 1mg?

1 mg of IGF-1 LR3 as Sterile freeze-dried powder, in a 3 mL vial, sealed and shipped dry. No diluent is included. The lot number is printed on the box.

Has IGF-1 LR3 1mg been tested?

IGF-1 LR3 1mg is sourced to order, so there is no lot in hand yet: the lot number and its certificate follow the batch that arrives. It is listed as assay pending, and we say so rather than showing a result from a different batch.

Does IGF-1 LR3 1mg come with a Certificate of Analysis?

Yes - a certificate for the lot you receive is available on request. Quote the lot number printed on the box. The certificate names that lot specifically; it is never averaged across batches or reused from an earlier one.

How is IGF-1 LR3 1mg shipped and stored?

It travels as a freeze-dried powder, which is stable in transit without a cold chain. Shipping is $20 flat anywhere in the United States, or free local pickup and delivery across Southwest Florida and Greater Philadelphia. Store the sealed vial as described on the label.

Is IGF-1 LR3 1mg approved for human use?

No. This material is supplied to qualified researchers for laboratory use only. It is not approved by the FDA or any other regulator for human or veterinary use, and nothing on this site is guidance on use.