Held and shipped from a United States warehouse. How testing works

CAUSALABS
Account Cart Contact
PNC-27 5mg vial

Product render, not a photograph — the vial and label are shown as supplied. Vials ship dry; no diluent is included.

Repair

PNC-27 5mg

99.38% purity

Measured by Sterigenix

Lot CL-2608-PNC27-A

View certificate
$75 $15.00 / mg · single 5 mg vial

Bundle & save

Pick how many, then add to cart. Same product, same order. Mix-and-match bundles are here.

Sourced to order · in hand within 2 days

US shipping $20 flat, or free local pickup. Same-week local pickup across Southwest Florida and Greater Philadelphia.

View cart → How testing works →

Part of the Summer 2026 Drop. Not restocked mid-drop — the next batch is a different lot with its own certificate.

For research use only. Not for human consumption. Not approved for medical use, treatment, or diagnosis.

Specification

Compound
PNC-27
Strength per vial
5 mg
Format
Single 5 mg vial - 2 or more for 15% off
Mass per vial
5 mg
Form
Sterile freeze-dried powder
Category
Repair
Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 amino acids) - p53(12-26) HDM-2-binding segment fused to the C-terminal penetratin-derived membrane-residency peptide KKWKMRRNQFWVKVQRG
CAS number
1159861-00-3
Molecular weight
4031.8 g/mol (free peptide, average mass)
Molecular formula
C188H293N53O44S
Testing laboratory
Sterigenix

Research context

PNC-27 is a synthetic 32-residue chimeric peptide joining residues 12-26 of human p53, the HDM-2-binding segment, to a C-terminal penetratin-derived membrane-residency sequence.

Full PNC-27 reference — chemistry, sequence and published context →

Storage & laboratory handling

  • Supplied as a sterile freeze-dried (lyophilised) powder, sealed under vacuum.
  • Ships dry. The vial is not reconstituted, and no diluent or solvent is included or sold with it.
  • Store the unopened vial refrigerated and protected from light.
  • Allow the vial to reach room temperature before breaking the seal, to limit condensation.
  • Handle under conditions appropriate to your laboratory's protocols.

Handling guidance covers storage of the material as supplied. It is not preparation or administration guidance, and none is provided.

Verification

PNC-27 is HPLC-MS tested for identity, purity and mass by an independent laboratory before it is listed. A certificate names the lot number printed on the box, so the document and the vial in front of you refer to the same batch, and is available on request.

Certificate for lot CL-2608-PNC27-A →

Related materials

Common questions

What exactly is in a vial of PNC-27 5mg?

5 mg of PNC-27 as Sterile freeze-dried powder, in a 3 mL vial, sealed and shipped dry. No diluent is included. The lot number is printed on the box.

What is the measured purity of PNC-27 5mg?

The current lot, CL-2608-PNC27-A, measured 99.38% by HPLC-MS at Sterigenix. Purity is the proportion of the sample that is this compound; it is not the same as how much peptide is in the vial. How to read a COA.

Does PNC-27 5mg come with a Certificate of Analysis?

Yes - a certificate for the lot you receive is available on request. Quote the lot number printed on the box. The certificate names that lot specifically; it is never averaged across batches or reused from an earlier one.

How is PNC-27 5mg shipped and stored?

It travels as a freeze-dried powder, which is stable in transit without a cold chain. Shipping is $20 flat anywhere in the United States, or free local pickup and delivery across Southwest Florida and Greater Philadelphia. Store the sealed vial as described on the label.

Is PNC-27 5mg approved for human use?

No. This material is supplied to qualified researchers for laboratory use only. It is not approved by the FDA or any other regulator for human or veterinary use, and nothing on this site is guidance on use.